DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and pinta

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:268 Identity:60/268 - (22%)
Similarity:117/268 - (43%) Gaps:16/268 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    23 NPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFK 87
            :|:.:...:|::.|.::..|.|....|.:.... |||..||....|.:.|..:::.|.:..:.|.
  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHF-FLRTSKFDVERAKKKLKTFYQMRAERTEWFD 81

Human    88 SFKATDPGIKQALKDG--FPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIE- 149
            :.....|.|:..||.|  .|.|   .|...|.::|:..|..|...::..::.:...:.|:.::: 
  Fly    82 NRDPQLPEIQDLLKLGVFLPIG---PDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKL 143

Human   150 DPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVI 214
            |||....|.|.|:|........|.::.|.:::.::|. ..::|.:...:.|.|.|.:::......
  Fly   144 DPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTF 207

Human   215 RPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGM-LPPYDMGTWARTLLDHEYDDDSEYNV 278
            |.|:..|.|.|:|:.....:     :..:.||.|.||. |...::....:.|::...|...|.  
  Fly   208 RIFMTPKIRSRLFVRREGTS-----VSCDQLPKELGGQGLSYMELSVKWKQLVEENADFYVEQ-- 265

Human   279 DSYSMPVK 286
            |.|...:|
  Fly   266 DKYKSKLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 30/145 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 60/268 (22%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.