DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG33965

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:312 Identity:73/312 - (23%)
Similarity:134/312 - (42%) Gaps:39/312 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    10 PETLEKARL-ELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLA 73
            |..|:|..: ||||.|..:..||..:::.:..:|.: ....:|.|:|.|||..||.         
  Fly    13 PPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHL-CACLEDQFLLSFLRGSKFS--------- 67

Human    74 QYFEYRQQNLDMFKSFKATDPGI--KQALKDGFP-------GGLANL----DHYGRKILVLFAAN 125
              .|..:|.:|.|.|.:|..|.:  .|.|.|...       |.:..:    :..|..:.::.|.:
  Fly    68 --LEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGS 130

Human   126 WDQSRYTLVDILRAILLSLE-AMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQD 189
            :|.:::...||:|...:..| .|:||....|:|::.|:|.|..|......|.|.:|........:
  Fly   131 YDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADE 195

Human   190 SFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLP 254
            :.|.|..||||:|.|......:..:..:...|.::|:.: .::..::.:.:....||.|:||   
  Fly   196 AMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVSV-SSDPEAIFERVPKHYLPEEYGG--- 256

Human   255 PYDMGTWARTLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDP 306
              ..||.      .:..|..|..:.||....::.:...:...::...||::|
  Fly   257 --SKGTM------KDITDQMEAKLCSYRSYFEDCQHFGAHDKLREEASVLNP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 11/45 (24%)
SEC14 106..251 CDD:238099 33/149 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 3/20 (15%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 13/56 (23%)
SEC14 101..256 CDD:238099 33/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.