DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG33966

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:293 Identity:86/293 - (29%)
Similarity:150/293 - (51%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLE-LNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKF-------- 63
            |||| |:|..:| |||.|:.|..||..:||.:..:|.:. .||||.|::.|||..||        
  Fly     7 LSPE-LQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLK-ARTDDQFLVNFLRGCKFSLERTKSK 69

Human    64 -HHFEAFRLLAQYFE-YRQQNLDMFKSFKATDPG----IKQALKDGFPGGLANLDHYGRKILVLF 122
             ..|  :.|..:|.| |...|:|:.|:.:....|    :.:.|.|.           |.::.:|.
  Fly    70 IDRF--YTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDN-----------GPRLALLR 121

Human   123 AANWDQSRYTLVDILRAILLSLEAMIEDPELQ-VNGFVLIIDWSNFTFKQASKLTPSMLRLAIEG 186
            .|.:|.|:|||.::.||..|..:.|:::.::. |||.:.|:|.||.|.....:::||..:.....
  Fly   122 MACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVF 186

Human   187 LQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFG- 250
            .:::.|.|..||||:|.|.....::.:|:|.:.:|.:.|:::||:...:|:..|..:.||.|:| 
  Fly   187 QEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGG 251

Human   251 --GMLPPYDMGTWARTLLDHE--YDDDSEYNVD 279
              |.:|.. :..|.:.:|.:.  ::::..|..|
  Fly   252 ENGSIPEL-LQQWEQRILAYRNYWEEEKNYGTD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 17/54 (31%)
SEC14 106..251 CDD:238099 42/148 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 14/42 (33%)
SEC14 96..252 CDD:238099 45/166 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.