DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG32407

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:237 Identity:50/237 - (21%)
Similarity:93/237 - (39%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     9 SPETLEKA------RLELNENPDTLH-QDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHF 66
            :||.:.:.      |||.....:..| .|::.:.|             .|.:|.:.|:.   :.|
  Fly     8 TPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITD-------------SDLWITKLLQV---YDF 56

Human    67 EAFRLLAQYFEYRQQNLDMFKSF---KATDPGIKQA-LKDGFPGGLANLDHYGRKILVLFAANWD 127
            :..:.:.:.::    ||...|||   ..|:..:.|. |.|| ...:.|.|..|:.:|:|......
  Fly    57 DVEKCITRLWD----NLAWRKSFGVYDITEANLNQEFLNDG-SIYVHNKDRDGKPLLILTIKKHS 116

Human   128 QSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFP 192
            :|| ...|:||.::..:|.:..|..|.     .|..:.:.|....|.|....::..|...:..:|
  Fly   117 KSR-NQEDLLRILVFWIERLQRDSNLD-----KITIFMDMTGAGLSNLDMGFIKSIIGVFETKYP 175

Human   193 ARFGGIHFVNQPWYIHALYTVIRPF--------LKEKTRKRI 226
            .....|...:.|:.:.|.:.:::.|        ||..|:|.|
  Fly   176 YVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 6/45 (13%)
SEC14 106..251 CDD:238099 28/129 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.