DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and Cralbp

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:260 Identity:70/260 - (26%)
Similarity:124/260 - (47%) Gaps:2/260 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     7 GLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRL 71
            ||....|:.|:.||.|:..|..|.::::|:.|....|:..:|.||.|:||||||:||....|.:.
  Fly    10 GLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQT 74

Human    72 LAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDI 136
            |.:|...|:....|.......:|.:...:..|:...:...|.:||:::|:.|...:...:|..|.
  Fly    75 LLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQ 139

Human   137 LRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFV 201
            .:|..|:.|.::||.|.|:.|...:.|::..|....:...|:......:..:.|.|.|...||.:
  Fly   140 AKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLI 204

Human   202 NQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDM-GTWARTL 265
            |.|..:..|...::..:..|.:.|:.::|:. ..|.:.:....||.|.||.:|..:| ..|.:.|
  Fly   205 NVPSTLKWLIDFVKNRVSSKMKNRLIIYGSE-KELMKSVDQGCLPLEMGGKVPMREMIELWKQEL 268

Human   266  265
              Fly   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 18/45 (40%)
SEC14 106..251 CDD:238099 33/144 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 18/46 (39%)
SEC14 101..254 CDD:238099 35/153 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4448
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.