DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG12926

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:318 Identity:80/318 - (25%)
Similarity:143/318 - (44%) Gaps:56/318 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72
            ||||..:||..||.|.||.:.:||:.:|..:..:|.:. .|.|..|::.|||..|:...:....|
  Fly    12 LSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLK-ARQDAQFLVAFLRGCKYSLEKTKLKL 75

Human    73 AQYFEYRQQNLDMFKS-------FKATDPG----IKQALKDGFPGGLANLDHYGRKILVLFAANW 126
            ..::..|....:::|:       ....|.|    :.|.|:  ..|...::..||:         :
  Fly    76 DNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQ--ADGPRIHISRYGQ---------Y 129

Human   127 DQSRYTLVDILRAILLSLEAMI-EDPELQVNGFVLIIDWSN------FTFKQASKLTPSMLRLAI 184
            |..:|::.::::...:..|..| ||....::|||.|||...      |.|...     .:.:||:
  Fly   130 DSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAV-----LVKKLAV 189

Human   185 EGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEF 249
            .| ..::|.|..|.||||.|.......::.:..:.||.|||..:| :.|:||::.:..|.||:|:
  Fly   190 LG-DKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEY 252

Human   250 GGMLPPYD--MGTWARTLLDHE--YDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSV 303
            ||......  :.||...||.::  :::::.|..:               :.::|.|.|
  Fly   253 GGSNGTIQDVVSTWRTKLLAYKPFFEEEASYGTN---------------EKLRRGQPV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 41/151 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 3/17 (18%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/45 (27%)
SEC14 117..254 CDD:238099 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.