DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG1902

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:315 Identity:80/315 - (25%)
Similarity:134/315 - (42%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72
            |.||..|.||.:|.|:|.:....|:.:|..:..:..:. .||||.|::.|||..::...||.:.:
  Fly     7 LEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLE-ARTDDQFLVAFLRFCRWDVEEAKKRV 70

Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDGF--------PGGLANLDHYGRKILVLFAANWDQS 129
            ..|:.|:.:..::.|..:..|..|:.|....|        |||  ...||.|      ..:.:.|
  Fly    71 LFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGG--PRIHYTR------MGHIEPS 127

Human   130 RYTLVDILRAILLSLEAMIE-DPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPA 193
            ::::.||.|......|..|. |....:.|.|.|||::...:....:..|.|.:.....|:...||
  Fly   128 KHSVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPA 192

Human   194 RFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDM 258
            .....|.||.......:..::|..:|:|  :.:.:| :.:.||.:.|..|.||.|.||     |.
  Fly   193 NLVATHIVNASRETQFVLGLVRNVMKQK--ELLHIH-STVASLRKAIGLEYLPVEMGG-----DN 249

Human   259 GTWARTLLDHE---------YDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVV 304
            |:.:..:..:|         :.:|..|.||       |..:|.|.|..:|...:|
  Fly   250 GSLSDAMTRYETQLLSFSPYFTEDERYGVD-------EKLREASEKDQERGAPLV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 36/145 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 6/18 (33%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/41 (29%)
CRAL_TRIO 100..248 CDD:279044 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.