DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG10026

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:252 Identity:70/252 - (27%)
Similarity:129/252 - (51%) Gaps:2/252 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    10 PETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQ 74
            ||.:.:...|..|.|.:..:.|::.|:.::...:....|:|..::.:|||||.:....:::||..
  Fly    25 PEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCS 89

Human    75 YFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRA 139
            |:.:|:||...::..:..|  ::...:..........|.:|.:||:.....|..::.|:.||.||
  Fly    90 YYRFREQNKSFYEKVRPLD--LRHVGQSDILTVTPYRDQHGHRILIYRFGLWRPNQVTVDDIFRA 152

Human   140 ILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQP 204
            .::..|....:|..|:.|.|.|.|..:...:....|:||:.:..|..|..|.|.|...:|.|||.
  Fly   153 TIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQN 217

Human   205 WYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTW 261
            |..:|.:.:.:|||....|:::::||:::.|||:.|:||.||..:||:...|....|
  Fly   218 WVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGGLHEDYSYTLW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 11/45 (24%)
SEC14 106..251 CDD:238099 45/144 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 46/152 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.