DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG10237

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:142/270 - (52%) Gaps:11/270 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    14 EKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEY 78
            |.|..||.|.|:...:..:|:..::....|:.:.:.::.:::|:||..|::...|..|:.:|:.:
  Fly    54 EVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIKRYYAF 118

Human    79 RQQNLDMFKSFKATDPG--IKQALKDGFPGGLANLDHYGRKILVL-FAANWDQSRYTLVDILRAI 140
            :.::.|::...|.::..  .|..:...||    |.|..||:|||| ....|...:.||.::.:..
  Fly   119 KVKHADVYTDLKPSNEANIFKHNILTVFP----NRDQLGRRILVLELGKRWKHKQVTLDEVFKGA 179

Human   141 LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPW 205
            :|.|||.:.:||.|:.|.|:|.|....:.:|..:.||...:..::.||||.|.|...||.||||.
  Fly   180 VLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQPK 244

Human   206 YIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGM--LPPYDMGTWARTLL-- 266
            ....::.:.:||||||.|.||..||.:..|||:.:.|:.||:.:||.  ....|...|.:.||  
  Fly   245 IFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGFREASRIDSDQWYQLLLKC 309

Human   267 DHEYDDDSEY 276
            |.|:|..:.|
  Fly   310 DTEFDTINSY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 8/45 (18%)
SEC14 106..251 CDD:238099 54/145 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 8/46 (17%)
SEC14 137..290 CDD:238099 57/156 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5179
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.