DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG33514

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:299 Identity:81/299 - (27%)
Similarity:139/299 - (46%) Gaps:25/299 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72
            |:||..:.|:.:|.|:|:.|..|:|..:..:..:|.:. .|.||.|::.|||..|:....|...|
  Fly     8 LTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLN-PRMDDQFLVAFLRGCKYSLERAKSKL 71

Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDG----FPGGLANLDHYGRKILVLFAANWDQSRYTL 133
            .:|:..:.:..|.|:....||...::..:.|    .|   ..|:..|.:|.:.........:||:
  Fly    72 DKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLP---TPLNENGPRIGIWRMGLVPVEKYTM 133

Human   134 VDILRAILLSLE-AMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGG 197
            ::.::......| |::||....|||.|.|:|....|.....::||||.:......:::.|.|...
  Fly   134 LECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKA 198

Human   198 IHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWA 262
            .||:|.......|:.:.:|.:.:|.:.|:|:|||.:..|.:.|..:.||.|:||     :.||..
  Fly   199 QHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGG-----ENGTTQ 258

Human   263 RTL------LDHEYDDDSEYNV----DSYSMPVKEVEKE 291
            ..:      || ||.|..:.||    |....|.|.::.|
  Fly   259 DIVAAMEKKLD-EYADFFQENVNFGTDESLRPGKPIDFE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 38/145 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 1/5 (20%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 13/46 (28%)
SEC14 97..253 CDD:238099 42/163 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.