DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG3823

DIOPT Version :9

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:307 Identity:66/307 - (21%)
Similarity:129/307 - (42%) Gaps:38/307 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTHLQAGLSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHH 65
            |.||.        |||..:|      :...|.:::|.:..:|.:. .......:.|||...:...
  Fly     1 MVHLN--------EKAEDQL------MTTRISDLQDWLQAQPQLP-QNISRLLLRRFLHTTRGDL 50

Human    66 FEAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALK--DGFPGGLANLDHYGRKILVLFAANWDQ 128
            ..|.|||...:..|.::..:|......|...:|.|:  |..|  |..|.....|:|.....::|.
  Fly    51 SAAQRLLELNYGLRNKHAHIFIDRDPLDASSQQLLQVADLVP--LPGLTPENNKLLFYRLIDFDA 113

Human   129 SRYTLVDILRAILLSLEAMI--EDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSF 191
            .::.....::...:..:...  |:.|...:|.:.:.|.:.:|.:..:|.....||:.::.:|::.
  Fly   114 DKFNFTAAIKVFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAH 178

Human   192 PARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPY 256
            |.|...||.:|.|.|:..:..|::||:|.:..|.|..|..|.::.::.....:||.|:||     
  Fly   179 PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGG----- 238

Human   257 DMG-------TWARTLLDHEYDDDSEYNVDSYSMPVKEVEKELSPKS 296
            :.|       .|.:.|     .:..:|.:|:.:..:.:::|....||
  Fly   239 EAGKMSDLKLQWMQLL-----KEQRDYLMDTENWQINKIKKNGQRKS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 10/45 (22%)
SEC14 106..251 CDD:238099 32/146 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 3/10 (30%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.