DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLVS2 and CG3091

DIOPT Version :10

Sequence 1:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens
Sequence 2:NP_569990.2 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:131/269 - (48%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     9 SPETLEKARLELNENPDTLHQDIQEVRDMVI---TRPDIGFLRTDDAFILRFLRARKFHHFEAFR 70
            :|||        :.:|.|...|  ::.|:|.   ..|::. .:.:...:||||:...| ..|..:
  Fly    11 APET--------SASPATGWSD--KLTDLVAWFEANPNLP-EKIEPIVMLRFLKCTAF-DVERTK 63

Human    71 LLAQYFEYRQQN------LDMFKSFKATDPGIKQA----LKDGFPGG-------LANLDHYGR-- 116
            .||: ..|..:|      :|.....:.|..|::.:    |....|.|       :|:||...|  
  Fly    64 ALAE-LNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNS 127

Human   117 ----KILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTP 177
                ||.|:.:    .:|:|..|:.|......:.::::.:: ..|.|.|:|...:|.:..:.::.
  Fly   128 VEETKIFVMMS----DARFTKPDVERETGSGADYVLDEADI-AEGDVQIVDIGGYTLRHLAYVSI 187

Human   178 SMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHP 242
            .:||:.::.||:::|:|...:|.:|.|.|:..|.:::.|||:|:.|..|..|...::||::.:..
  Fly   188 FVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPR 252

Human   243 EILPSEFGG 251
            ::||:|:||
  Fly   253 DMLPNEYGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/48 (25%)
SEC14 101..251 CDD:469559 41/162 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
CG3091NP_569990.2 SEC14 99..262 CDD:469559 44/168 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.