powered by:
Protein Alignment ATPSCKMT and Art6
DIOPT Version :9
Sequence 1: | NP_954584.2 |
Gene: | ATPSCKMT / 134145 |
HGNCID: | 27029 |
Length: | 233 |
Species: | Homo sapiens |
Sequence 2: | NP_650322.1 |
Gene: | Art6 / 41699 |
FlyBaseID: | FBgn0038189 |
Length: | 341 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 17/72 - (23%) |
Similarity: | 29/72 - (40%) |
Gaps: | 25/72 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 68 LPFVPA-------TTKQIENVVKMLR------------CRRGSL------VDIGSGDGRIVIAAA 107
|||:.. :..::|..:.||| .:.|.| :|:|.|.|.:.:.||
Fly 9 LPFLEGKDSDYFQSYSRLETHMNMLRDSVRMQAFRDAIVQDGGLFQDKIVLDVGCGTGILSLFAA 73
Human 108 KKGFTAV 114
:.|.:.|
Fly 74 EAGASKV 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.