DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPSCKMT and Art4

DIOPT Version :9

Sequence 1:NP_954584.2 Gene:ATPSCKMT / 134145 HGNCID:27029 Length:233 Species:Homo sapiens
Sequence 2:NP_001262445.1 Gene:Art4 / 41219 FlyBaseID:FBgn0037770 Length:530 Species:Drosophila melanogaster


Alignment Length:87 Identity:18/87 - (20%)
Similarity:35/87 - (40%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    92 LVDIGSGDGRIVIAAAKKGFTAVGYELNPW-LVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYS 155
            ::|:|:|.|.:...|.:.|...| |.:... :..|::.......|..........:.::...:..
  Fly   183 VLDVGAGSGILSFFAVQAGAAKV-YAIEASNMAQYAQQLVESNNVQHKISVIPGKIEEIELPEKV 246

Human   156 NVVIFGVPQMMLQLEKKLEREL 177
            :|:|......||..|:.||..|
  Fly   247 DVIISEPMGYMLYNERMLETYL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPSCKMTNP_954584.2 Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 56..90
AdoMet_MTases 83..>188 CDD:388410 18/87 (21%)
Art4NP_001262445.1 PH-like 24..134 CDD:302622
PRMT5 53..430 CDD:282971 18/87 (21%)
AdoMet_MTases 183..281 CDD:100107 18/87 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.