DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPSCKMT and Art7

DIOPT Version :9

Sequence 1:NP_954584.2 Gene:ATPSCKMT / 134145 HGNCID:27029 Length:233 Species:Homo sapiens
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:158 Identity:29/158 - (18%)
Similarity:54/158 - (34%) Gaps:61/158 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   125 YSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMM----------------------- 166
            |||.|..:.......|.|:..|.:...::.|||::.|...::                       
  Fly   382 YSRSRIGQLNQSPRNKRYLRYLEESIEAEKSNVLVLGNGCLLGLASSALGAASVLLHEPHRFSRR 446

Human   167 -------------LQLEKKLERELEDDARVIACR--FPFPHWTPDHVTGEGIDTVWAYDASTF-- 214
                         :|...|:| ||| |:|:.|..  |..|::         ::.:..:|...|  
  Fly   447 LIESIVKHNQLKNVQFLDKVE-ELE-DSRLAALTHIFAEPYF---------LNAILPWDNFYFGT 500

Human   215 ----------RGREKRPCTSMHFQLPIQ 232
                      .|.:..||::..:.||::
  Fly   501 LLTKIKDRLPEGVKISPCSARIYALPVE 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPSCKMTNP_954584.2 Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 56..90
AdoMet_MTases 83..>188 CDD:388410 20/100 (20%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.