DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ATPSCKMT and Art8

DIOPT Version :9

Sequence 1:	NP_954584.2	Gene:	ATPSCKMT / 134145	HGNCID:	27029	Length:	233	Species:	Homo sapiens
Sequence 2:	NP_609478.1	Gene:	Art8 / 34528	FlyBaseID:	FBgn0032329	Length:	341	Species:	Drosophila melanogaster

Alignment Length:	147	Identity:	37/147 - (25%)
Similarity:	50/147 - (34%)	Gaps:	60/147 - (40%)

- Green bases have known domain annotations that are detailed below.

Human    17 QSR---HVLPASFEVNSLQKSNW-GFLL--TGLVGGTLVA-----------VYAVATPFVTPALR 64
            |||   .||||..|...:..|.| ||.|  .|::...|:|           ..:..|.||.|.
  Fly    96 QSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPC-- 158

Human    65 KVCLPFVPATTKQIENV--VKM------LRCRRGS-----------------------LVDIGSG 98
                 .||:......||  :||      ||.::.|                       |:|:.:.
  Fly   159 -----SVPSLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEAS 218

Human    99 D-----GRIVIAAAKKG 110
            |     .:.||.|.|.|
  Fly   219 DLDSIQFKEVITAQKAG 235

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ATPSCKMT	NP_954584.2	Required for mitochondrial location. /evidence=ECO:0000269\|PubMed:30530489	56..90		12/41 (29%)
ATPSCKMT	NP_954584.2	AdoMet_MTases	83..>188	CDD:388410	13/62 (21%)
Art8	NP_609478.1	SmtA	1..244	CDD:223574	37/147 (25%)
Art8	NP_609478.1	Methyltransf_18	40..147	CDD:289607	16/50 (32%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900