DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dmp1 and CG1647

DIOPT Version :9

Sequence 1:NP_001345942.1 Gene:Dmp1 / 13406 MGIID:94910 Length:503 Species:Mus musculus
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:597 Identity:120/597 - (20%)
Similarity:195/597 - (32%) Gaps:201/597 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 ALPVARYHNTESESSEER--TG--DLAGSPPPPTNS-------ESSEES----QASPE----GQA 61
            |.|....|..:|..|..|  ||  :.....||.||:       .|.|.:    ...||    |..
  Fly   686 ACPEDSLHKVKSVKSTARKSTGGAERKTYSPPRTNTLPQIVAVVSGESAFNMISIKPEPRNLGYG 750

Mouse    62 NSDHTDSSESGEELGY-----DRGQYRPAGGLSKST------------------GTGADKEDDED 103
            :.:..|..|:.||:.:     :..:|  .|.|..|.                  ..|.:|.|::|
  Fly   751 DEEPEDQRETTEEINHNDMMEEEKEY--IGSLDLSDVSVKQERELDICEIDAVHRNGLEKSDEDD 813

Mouse   104 DSGDD---TFGDE---------------DNDLGPEEGQWGGPSKLDSDEDSTDTTQSSEDSTSQE 150
            |.|::   :..||               :.:|.|.|.| ...|:.|.:.:..||    |.||:. 
  Fly   814 DDGNEDSASSADEAEEAMERDTEERIYREIELPPLELQ-NESSRKDLESERMDT----EVSTAL- 872

Mouse   151 NSAQDTPSDSKD----HDSEDEADS------------RPEAGDSTQDSESEEQRVGGGSEGESSH 199
             .|.:|||.::|    ..||..|.|            :|.|..|.                    
  Fly   873 -PASETPSQTRDVLGVEKSEASAFSLVITNICSQAVPQPSAACSN-------------------- 916

Mouse   200 GDGSEFDDEGMQSDDPESTRSDRGHARMSSAGIRSEESKGDHEPTSTQDSDDSQSVE----FSSR 260
                  |.|......|.:|.....|.      :.:.:|..:...||.|.:..:||..    .|..
  Fly   917 ------DIECSIGPSPSTTNEPHSHT------VENVQSPANDLQTSAQVAIAAQSQPDPCIVSQP 969

Mouse   261 KSFRRSHVSEEDY---RGELTDSNSR--------ETQSDSTEDTASKEESRSE-------SQEDT 307
            .:...|....:|.   ..::...|:.        ||:.:|.|:.||..|||::       ::..:
  Fly   970 AASSESQADTKDLPPAASQIQTFNTESLPIHVHSETEDNSIENDASYLESRAQVDCQSAGTENPS 1034

Mouse   308 AESQSQEDSPEGQ--DPSSESSEEAGEPSQESSSESQEGVTSESRGDNPDNTSQAGDQEDSESSE 370
            ...:..|..|.|.  .|..|:......|.|...|||.                   |:.:..:..
  Fly  1035 VVLEQNESLPSGSCVSPIPENPSPGNSPPQHDESESL-------------------DKPEMAAGS 1080

Mouse   371 EDSLNTFSSSESQSTEEQA----DSESNESLSLSEESQESAQDGDSSSQE--------------- 416
            ...|.|.|....:.||..|    |:...:|...|:|.|::..:.:.|.|:               
  Fly  1081 AYCLATVSLDAPKDTEALALPPCDAAIIDSNYTSDEEQQNVLNHELSEQQLAIMEHRQLLVHEEQ 1145

Mouse   417 ---------GLQSQS-ASTESRSQESQ------SEQDSRSEEDSDSQDSSRSKEESNST------ 459
                     ||.|:. ..||:|..|.|      .|:..|.:.:.||..:..::..:|:.      
  Fly  1146 PALLEVIPPGLSSRPIEETENRINEQQQDLEQGEERPPRFQANDDSNINEIAENNNNANIERELQ 1210

Mouse   460 GSASSSEEDIRP 471
            ..|..::|::.|
  Fly  1211 DDALGAQENVNP 1222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dmp1NP_001345942.1 DMP1 1..503 CDD:311295 120/597 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..503 118/590 (20%)
Cell attachment site. /evidence=ECO:0000255 350..352 0/1 (0%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.