DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B1 and CG42376

DIOPT Version :10

Sequence 1:NP_001854.1 Gene:COX6B1 / 1340 HGNCID:2280 Length:86 Species:Homo sapiens
Sequence 2:NP_001138136.1 Gene:CG42376 / 7354420 FlyBaseID:FBgn0259722 Length:92 Species:Drosophila melanogaster


Alignment Length:72 Identity:17/72 - (23%)
Similarity:33/72 - (45%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    21 FPNQNQTRNCWQNYLDFHRCQKAMTAKGGDIS------VCEWYQRVYQSLCPTSWVTDWDEQRAE 79
            ||::.:.:.||.|..::.:|.:....|....|      .|:..::.::..||..||..:|.:|..
  Fly     3 FPDKAERKKCWNNRDEYWKCLEEHAPKHSSTSGEKVPTPCQSLRKSFEQSCPGQWVKHFDRKRTY 67

Human    80 GTFPGKI 86
            ..|..|:
  Fly    68 DQFKEKM 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6B1NP_001854.1 Cyt_c_Oxidase_VIb 8..85 CDD:238466 16/69 (23%)
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 30..40 3/9 (33%)
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 54..65 1/10 (10%)
CG42376NP_001138136.1 COX6B 3..67 CDD:426708 15/63 (24%)

Return to query results.
Submit another query.