DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6B1 and COX6B

DIOPT Version :10

Sequence 1:NP_001854.1 Gene:COX6B1 / 1340 HGNCID:2280 Length:86 Species:Homo sapiens
Sequence 2:NP_728294.1 Gene:COX6B / 32989 FlyBaseID:FBgn0031066 Length:96 Species:Drosophila melanogaster


Alignment Length:77 Identity:46/77 - (59%)
Similarity:59/77 - (76%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    12 YK--TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWD 74
            ||  |||||.||||||.||.|:|:|:|||||||   .:|.|.:.|.::|:||:|:||.:||..||
  Fly    23 YKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQK---KRGEDFAPCNYFQKVYKSMCPNAWVEKWD 84

Human    75 EQRAEGTFPGKI 86
            :||..|||||:|
  Fly    85 DQRESGTFPGRI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6B1NP_001854.1 Cyt_c_Oxidase_VIb 8..85 CDD:238466 44/74 (59%)
Cx9C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 30..40 6/9 (67%)
Cx10C motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 54..65 5/10 (50%)
COX6BNP_728294.1 Cyt_c_Oxidase_VIb 22..95 CDD:238466 44/74 (59%)

Return to query results.
Submit another query.