DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX6A2 and levy

DIOPT Version :9

Sequence 1:NP_005196.1 Gene:COX6A2 / 1339 HGNCID:2279 Length:97 Species:Homo sapiens
Sequence 2:NP_001286770.1 Gene:levy / 37728 FlyBaseID:FBgn0034877 Length:109 Species:Drosophila melanogaster


Alignment Length:86 Identity:42/86 - (48%)
Similarity:55/86 - (63%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    14 SAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYL---HSGHRPRPEFRPYQHLRIRTKPYPWG 75
            :|..|.|.| |.:.|:.|:|.:|:|:|.||..|:||   ....:||.||..|.:||.|.|.:|||
  Fly    25 AAVAGEHSG-GYKVWKRLSFFVAVPAVGLCMLNAYLKHQEEHDKPRQEFVKYDYLRRREKRFPWG 88

Human    76 DGNHTLFHNSHVNPLPTGYEH 96
            :|..:||||.|||.||.||||
  Fly    89 EGQKSLFHNPHVNALPDGYEH 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX6A2NP_005196.1 Cyt_c_Oxidase_VIa 26..95 CDD:238465 34/71 (48%)
levyNP_001286770.1 Cyt_c_Oxidase_VIa 24..108 CDD:238465 39/83 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3469
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4989
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47989
OrthoDB 1 1.010 - - D1591077at2759
OrthoFinder 1 1.000 - - FOG0001528
OrthoInspector 1 1.000 - - otm41832
orthoMCL 1 0.900 - - OOG6_102857
Panther 1 1.100 - - O PTHR11504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R240
SonicParanoid 1 1.000 - - X1250
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.