DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EGFLAM and Nrg

DIOPT Version :10

Sequence 1:NP_001192230.1 Gene:EGFLAM / 133584 HGNCID:26810 Length:1017 Species:Homo sapiens
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:400 Identity:89/400 - (22%)
Similarity:146/400 - (36%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    46 LNCTAFSIQWKMPRHPGSPILGYTVFYSEVGADKSLQEQLHSVPLSRDIPTTEEVIGDLKPGTEY 110
            |..:||.:.||.|.:|...:.||.::|.|| .:..:.|:....|...|...|...:..|||.::|
  Fly   928 LGSSAFMLHWKKPLYPNGKLTGYKIYYEEV-KESYVGERREYDPHITDPRVTRMKMAGLKPNSKY 991

Human   111 RVSIAAYSQAGKGRLSSPRHV--TTLSQDSCLPPAAPQQPHVIVVSDSEVA---LSWKPGASEGS 170
            |:||.|.::.|:|   |..::  |||.....:.||.|......:.||:.:|   ::|.| ::||.
  Fly   992 RISITATTKMGEG---SEHYIEKTTLKDAVNVAPATPSFSWEQLPSDNGLAKFRINWLP-STEGH 1052

Human   171 APIQYYSVEFIRPDFDKKWTSIHERIQMDSMVIKGLDPDTNYQFAVRAMNSH------------- 222
            ....::::..|:.  :.:|...:|....|...:.||||:|.|:|.|.:::.|             
  Fly  1053 PGTHFFTMHRIKG--ETQWIRENEEKNSDYQEVGGLDPETAYEFRVVSVDGHFNTESATQEIDTN 1115

Human   223 ---GP--------SPRSWPSDIIRTLC----------------------------------PEEA 242
               ||        :...|...::..|.                                  |||.
  Fly  1116 TVEGPIMVANETVANAGWFIGMMLALAFIIILFIIICIIRRNRGGKYDVHDRELANGRRDYPEEG 1180

Human   243 GSGRYGPRYITDMGAGE------DDEGFEDDLDLDISFEEVKPLPATKGGNKKFLVESKKMSI-- 299
            |...|. :.:.:..||.      :..|.|.|.|....:.:.....||..........||..|:  
  Fly  1181 GFHEYS-QPLDNKSAGRQSVSSANKPGVESDTDSMAEYGDGDTAVATAAARAAAAARSKLTSLPT 1244

Human   300 ----------------SNPKTISRLIPPTSAS-LPVTTVA-PQPIPIQRKGKNGVAIMSRLFDMP 346
                            ..|::       |||| :|:.::| |.|.|.........|        |
  Fly  1245 STQQQQQQQQQQQQQQEQPQS-------TSASTVPLISLASPSPSPSSTSNSPTAA--------P 1294

Human   347 CDETLCSADS 356
            ....||.||:
  Fly  1295 PSYELCVADA 1304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EGFLAMNP_001192230.1 FN3 36..133 CDD:238020 27/88 (31%)
FN3 142..234 CDD:238020 26/118 (22%)
LamG 391..541 CDD:238058
EGF_CA 560..602 CDD:238011
LamG 618..765 CDD:238058
EGF_CA <792..820 CDD:238011
Laminin_G_2 868..993 CDD:460494
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 314..319 CDD:409353
Ig strand G 328..331 CDD:409353
IgI_4_hemolin-like 339..427 CDD:409570
Ig strand A 339..342 CDD:409570
Ig strand A' 348..351 CDD:409570
Ig strand B 356..363 CDD:409570
Ig strand C 369..374 CDD:409570
Ig strand C' 377..379 CDD:409570
Ig strand D 387..391 CDD:409570
Ig strand E 393..397 CDD:409570
Ig strand F 406..414 CDD:409570
Ig strand G 417..427 CDD:409570
Ig 446..517 CDD:472250
Ig strand B 449..453 CDD:409358
Ig strand C 462..466 CDD:409358
Ig strand E 483..487 CDD:409358
Ig strand F 497..502 CDD:409358
Ig strand G 510..513 CDD:409358
Ig 521..615 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 553..557 CDD:409353
Ig strand E 577..581 CDD:409353
Ig strand F 591..596 CDD:409353
Ig strand G 604..607 CDD:409353
FN3 613..707 CDD:238020
FN3 683..>1051 CDD:442628 38/127 (30%)
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996 27/82 (33%)
FN3 1041..1111 CDD:238020 17/72 (24%)
Bravo_FIGEY 1155..>1221 CDD:464016 11/66 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.