DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Twist2 and twi

DIOPT Version :9

Sequence 1:NP_031881.1 Gene:Twist2 / 13345 MGIID:104685 Length:160 Species:Mus musculus
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:213 Identity:74/213 - (34%)
Similarity:98/213 - (46%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 PVDSL-GTSEEELERQPKRFGRKRRYSKKS------------SEDGSP---------------TP 47
            |.:|| |::....:|....:.|....|..|            ::|||.               .|
  Fly   279 PANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKP 343

Mouse    48 GKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAAR 112
            .:|.|:.....:..:|..:||::|||||||||||||:||.:|::|||||||||||||||||||.|
  Fly   344 RRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATR 408

Mouse   113 YIDFLYQVLQSDEMD-----------------------------------NKMTSCSYVAHERLS 142
            |||||.::|.|.::.                                   .|......:..|:||
  Fly   409 YIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLS 473

Mouse   143 YAFSVWRMEGAWSMSASH 160
            |.|.||||||    .|.|
  Fly   474 YLFGVWRMEG----DAQH 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Twist2NP_031881.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 14/79 (18%)
bHLH_TS_TWIST2 51..132 CDD:381543 48/115 (42%)
twiNP_001033967.1 HLH 363..413 CDD:278439 41/49 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839669
Domainoid 1 1.000 90 1.000 Domainoid score I7765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm43384
orthoMCL 1 0.900 - - OOG6_107717
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.