DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPC4L and pabpc1l

DIOPT Version :9

Sequence 1:NP_001108206.3 Gene:PABPC4L / 132430 HGNCID:31955 Length:370 Species:Homo sapiens
Sequence 2:NP_001005062.1 Gene:pabpc1l / 448615 XenbaseID:XB-GENE-5742459 Length:629 Species:Xenopus tropicalis


Alignment Length:370 Identity:246/370 - (66%)
Similarity:308/370 - (83%) Gaps:1/370 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MN-VAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADA 64
            || ..|.|.:|||||||||.||||.:|:.|||..||::|||:|||..|||||||||:||.|.|||
 Frog     1 MNATGAGYPLASLYVGDLHPDVTEAMLYEKFSPAGPIMSIRVCRDIATRRSLGYAYINFQQPADA 65

Human    65 QKALDTMNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKV 129
            ::|||||||::|||:.||:||||||..||:||:|||||||||:|||||.||:.|||||.|||.||
 Frog    66 ERALDTMNFEVIKGRPIRIMWSQRDPGLRKSGVGNVFIKNLDESIDNKALYDTFSAFGNILSCKV 130

Human   130 MSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREAELRSKASEFTNVYI 194
            :.|:.||:||.||||:.|.||:|||:.|||.||...|||||.||:|::||.|..:|..|||||||
 Frog   131 VCDEHGSRGYGFVHFETQEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVMEFTNVYI 195

Human   195 KNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDINGQL 259
            ||||.||||:||:::||.:|.|||||||.|.:|:|:|||||::.:||.|:|||.||||:::||::
 Frog   196 KNFGEDMDDKRLREIFSAFGNTLSVKVMMDDTGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRM 260

Human   260 IFVGRAQKKVERQAELKQMFEQLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKV 324
            |:||||||::|||.|||:.|||:|:|||...|||.||:|||||.|||::||.|||.:|:|:..||
 Frog   261 IYVGRAQKRIERQGELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFSPYGTITSAKV 325

Human   325 MQEEGQSKGFGLICFSSPEDATKAMTEMNGRILGSKPLSIALAQR 369
            |.|.|.|||||.:||||||:||||:|||||||:.:|||.:|||||
 Frog   326 MTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVSTKPLYVALAQR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPC4LNP_001108206.3 RRM 10..>369 CDD:330708 240/358 (67%)
pabpc1lNP_001005062.1 PABP-1234 11..612 CDD:130689 242/360 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.