DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dcx and CaMKI

DIOPT Version :9

Sequence 1:NP_001103692.1 Gene:Dcx / 13193 MGIID:1277171 Length:366 Species:Mus musculus
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:78/232 - (33%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    95 INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKV----------EYTKN---VNPNW 146
            :|....:...|.:.|....|:..|:...||.....::|..|:          |..:|   |...:
  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRF 85

Mouse   147 SVNVKTSANMKAPQSLASSNSAQARE-----NKDFVRPKLVT-------IIRSGVKPRKAVRVLL 199
            |.|......:...: |...|..|..|     :|.::..:|||       |:..|        ...
  Fly    86 SANHFDGKCLNGTR-LTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKG--------SYT 141

Mouse   200 NKKTAHSFEQVLTDITEAIKL--ETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQD 262
            .|..:|...|:|    ||:..  |.|||.:    |.|....|: :..|||..|..         .
  Fly   142 EKDASHLIRQIL----EAVDYMHEQGVVHR----DLKPENLLY-YSPDDDSKIMI---------S 188

Mouse   263 DFSLDENECRVMKGNPSAAAGPKASPTPQKTSAKSPG 299
            ||.|.:.|   ..|..:.|.|......|:..:.|..|
  Fly   189 DFGLSKME---DSGIMATACGTPGYVAPEVLAQKPYG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DcxNP_001103692.1 DCX1_DCX 51..139 CDD:340529 10/53 (19%)
DCX2 176..259 CDD:340589 22/91 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..366 6/25 (24%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 50/226 (22%)
S_TKc 31..302 CDD:214567 50/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.