DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcbd1 and Pcd

DIOPT Version :9

Sequence 1:NP_079549.1 Gene:Pcbd1 / 13180 MGIID:94873 Length:104 Species:Mus musculus
Sequence 2:NP_477360.2 Gene:Pcd / 43499 FlyBaseID:FBgn0024841 Length:192 Species:Drosophila melanogaster


Alignment Length:94 Identity:58/94 - (61%)
Similarity:70/94 - (74%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 RLSAEERDQLLPNLRAVGWNEVEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYN 71
            ||:.:||.:.|..|...||..|||||||||||..||||:||.|||.|||.|||::|||||||.||
  Fly    95 RLNEQERAEKLQPLLDAGWTLVEGRDAIFKQFVLKDFNQAFSFMTGVALLAEKINHHPEWFNCYN 159

Mouse    72 KVHITLSTHECAGLSERDINLASFIEQVA 100
            ||.:|||||:..|||.:||.:|:.:|..|
  Fly   160 KVDVTLSTHDVGGLSSQDIRMATHLETTA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcbd1NP_079549.1 PCD_DCoH_subfamily_b 24..99 CDD:238456 51/74 (69%)
Substrate binding. /evidence=ECO:0000250 61..63 0/1 (0%)
Substrate binding. /evidence=ECO:0000250 78..81 2/2 (100%)
PcdNP_477360.2 PCD_DCoH_subfamily_b 112..186 CDD:238456 50/73 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845551
Domainoid 1 1.000 121 1.000 Domainoid score I5690
eggNOG 1 0.900 - - E1_COG2154
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H57028
Inparanoid 1 1.050 113 1.000 Inparanoid score I4840
Isobase 1 0.950 - 0 Normalized mean entropy S2539
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002149
OrthoInspector 1 1.000 - - otm43144
orthoMCL 1 0.900 - - OOG6_100957
Panther 1 1.100 - - LDO PTHR12599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2723
SonicParanoid 1 1.000 - - X2565
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.