Sequence 1: | NP_001177380.1 | Gene: | Dcn / 13179 | MGIID: | 94872 | Length: | 354 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
Alignment Length: | 305 | Identity: | 72/305 - (23%) |
---|---|---|---|
Similarity: | 133/305 - (43%) | Gaps: | 65/305 - (21%) |
- Green bases have known domain annotations that are detailed below.
Mouse 81 LDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELP----E 141
Mouse 142 KMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRI---- 202
Mouse 203 ----------SDTNITA--IPQGLPTS-----------------------------------LTE 220
Mouse 221 VHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQ 285
Mouse 286 -HKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPV 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dcn | NP_001177380.1 | LRRNT | 48..80 | CDD:214470 | |
leucine-rich repeat | 57..77 | CDD:275380 | |||
LRR 1 | 68..88 | 3/6 (50%) | |||
leucine-rich repeat | 78..101 | CDD:275380 | 4/19 (21%) | ||
LRR_RI | <79..285 | CDD:238064 | 64/258 (25%) | ||
LRR_8 | 79..136 | CDD:290566 | 16/54 (30%) | ||
LRR 2 | 89..112 | 5/22 (23%) | |||
leucine-rich repeat | 102..125 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 113..136 | 8/22 (36%) | |||
leucine-rich repeat | 126..146 | CDD:275380 | 9/23 (39%) | ||
LRR 4 | 137..157 | 7/23 (30%) | |||
LRR_8 | 145..207 | CDD:290566 | 20/75 (27%) | ||
leucine-rich repeat | 147..170 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 158..181 | 6/22 (27%) | |||
leucine-rich repeat | 171..196 | CDD:275380 | 8/24 (33%) | ||
LRR 6 | 182..207 | 8/38 (21%) | |||
leucine-rich repeat | 197..217 | CDD:275380 | 6/35 (17%) | ||
LRR 7 | 208..228 | 6/56 (11%) | |||
LRR_8 | 216..276 | CDD:290566 | 19/94 (20%) | ||
leucine-rich repeat | 218..241 | CDD:275380 | 9/22 (41%) | ||
LRR 8 | 229..252 | 9/22 (41%) | |||
leucine-rich repeat | 242..265 | CDD:275380 | 6/22 (27%) | ||
LRR 9 | 253..276 | 5/22 (23%) | |||
LRR_8 | 264..>307 | CDD:290566 | 10/43 (23%) | ||
LRR 10 | 277..299 | 5/22 (23%) | |||
leucine-rich repeat | 289..309 | CDD:275380 | 4/19 (21%) | ||
LRR 11 | 300..329 | 4/28 (14%) | |||
LRR 12 | 330..354 | 72/305 (24%) | |||
CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
LRR_8 | 64..123 | CDD:290566 | 16/54 (30%) | ||
leucine-rich repeat | 65..88 | CDD:275380 | 4/19 (21%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 8/22 (36%) | ||
LRR_RI | 115..384 | CDD:238064 | 60/258 (23%) | ||
LRR_8 | 135..195 | CDD:290566 | 19/62 (31%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 184..243 | CDD:290566 | 7/58 (12%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 232..289 | CDD:290566 | 12/56 (21%) | ||
leucine-rich repeat | 233..256 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 257..280 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 280..339 | CDD:290566 | 15/58 (26%) | ||
leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 305..328 | CDD:275380 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45712 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |