DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dclk1 and CG10126

DIOPT Version :9

Sequence 1:	NP_064362.1	Gene:	Dclk1 / 13175	MGIID:	1330861	Length:	756	Species:	Mus musculus
Sequence 2:	NP_788664.2	Gene:	CG10126 / 41579	FlyBaseID:	FBgn0038088	Length:	227	Species:	Drosophila melanogaster

Alignment Length:	164	Identity:	35/164 - (21%)
Similarity:	58/164 - (35%)	Gaps:	55/164 - (33%)

- Green bases have known domain annotations that are detailed below.

Mouse   459 VKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTSKY-TERDASGMLYNLASAIKYLH--- 519
            :|:||..|...|.::.::  .:.||..|.|. |.||..... ..|.|:|:| .|..|.:.:.
  Fly    13 LKNPNCDLYTLEANMASQ--ALRELTDGEDK-DPITKLRLLCLSRGATGIL-GLGRAFRAMDDDG 73

Mouse   520 ----------------SLNIVHRDIKPENLLVYEHQDGSKSLKLGDF------------------ 550
                            .|::...:||  .:.....:|||.|:.:.:|
  Fly    74 SKALNEEEFITGIRDTGLDVSEEEIK--QMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQ 136

Mouse   551 ----------GLATIVD-GPLYTVCGTPTYVAPE 573
                      |:.||.| ..:|:|...|.|.:.|
  Fly   137 AFNKMDRDEDGVITIQDLKNVYSVKEHPKYQSGE 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dclk1	NP_064362.1	DCX	52..142	CDD:214711
		DCX	181..269	CDD:214711
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	288..393
		STKc_DCKL1	399..666	CDD:271085	35/164 (21%)
		S_TKc	406..663	CDD:214567	35/164 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	711..756
CG10126	NP_788664.2	EF-hand_7	62..119	CDD:290234	9/58 (16%)
		EFh	64..119	CDD:238008	8/56 (14%)
		EFh	97..154	CDD:238008	10/58 (17%)
		EF-hand_7	98..158	CDD:290234	11/61 (18%)
		EF-hand_7	134..204	CDD:290234	9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0032
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900