DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC31A1 and ctr6

DIOPT Version :10

Sequence 1:NP_001850.1 Gene:SLC31A1 / 1317 HGNCID:11016 Length:190 Species:Homo sapiens
Sequence 2:NP_595861.1 Gene:ctr6 / 2540641 PomBaseID:SPBC23G7.16 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:41/140 - (29%)
Similarity:70/140 - (50%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    35 GGDSSM--MMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKS 97
            ||:|:|  ..|.|||...:.|:.::|....|....:...:.:|:.:|...:|.|:  ..:.|:::
pombe     4 GGNSTMRHCSMKMTFNTDYDNLCIVFKSWHIGNLSQFLLSLLAIAILGYLFERLR--SFTSLKET 66

Human    98 QVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCI 162
            :....|......|      :.||.:  :.:.|........|:.:|:|.||||||:.||||.|:.:
pombe    67 EFQRGYAGQQSEG------LLTHHS--KSLKSGRPFRLCALYAVQLVFSYFLMLVAMTYNAYVIL 123

Human   163 AVAAGAGTGY 172
            |:|.||..||
pombe   124 AIAIGAAFGY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC31A1NP_001850.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 41/140 (29%)
Bis-His motif. /evidence=ECO:0000269|Ref.24 5..6
Methionine segments (Mets) motif. /evidence=ECO:0000269|Ref.24 7..12
Ctr 45..175 CDD:461194 36/128 (28%)
ctr6NP_595861.1 Ctr 16..133 CDD:461194 34/126 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.