DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dapk3 and CaMKI

DIOPT Version :9

Sequence 1:NP_001177403.2 Gene:Dapk3 / 13144 MGIID:1203520 Length:465 Species:Mus musculus
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:287 Identity:106/287 - (36%)
Similarity:161/287 - (56%) Gaps:23/287 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    22 RQEDVEDHYEMGEELGSGQFAIVRKCQQKGT-GMEYAAKFIKKRRLPSSRRGVSREEIEREVSIL 85
            :|..:|:.|.:...||:|.|:.||..:.|.: |..:|.|.|.|:.|..     ..|.:|.|:.:|
  Fly    23 KQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG-----KEESLENEIRVL 82

Mouse    86 R---------------EIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQ 135
            |               .:.||||:.|.:.:|:|:.|.|::|||:||||||.:.||.|.||.:|:.
  Fly    83 RRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASH 147

Mouse   136 FLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEF 200
            .::|||:.|.|:|.:.:.|.||||||::.......| :|.:.|||:: ::|.........|||.:
  Fly   148 LIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDS-KIMISDFGLS-KMEDSGIMATACGTPGY 210

Mouse   201 VAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELA 265
            ||||::..:|.|...|:||||||:||||.|..||..|........|...:::||..|:...||.|
  Fly   211 VAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESA 275

Mouse   266 KDFIRRLLVKDPKRRMTIAQSLEHSWI 292
            |.||:.|:....::|.|..|:|.|:||
  Fly   276 KHFIKNLMCVTVEKRYTCKQALGHAWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dapk3NP_001177403.2 STKc_DAPK 24..292 CDD:271007 103/283 (36%)
S_TKc 30..292 CDD:214567 102/277 (37%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 103/280 (37%)
S_TKc 31..302 CDD:214567 102/277 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.