DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dapk2 and CaMKI

DIOPT Version :9

Sequence 1:XP_036010488.1 Gene:Dapk2 / 13143 MGIID:1341297 Length:490 Species:Mus musculus
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:355 Identity:119/355 - (33%)
Similarity:187/355 - (52%) Gaps:54/355 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    12 ETFKQQKVEDFYDIGEELGSGQFAIVKKCREK-STGLEYAAKFIKKRQSRASRRGVCREEIEREV 75
            |..||..:|:.|::...||:|.|:.|:....| |.|..:|.|.|.|:..:..     .|.:|.|:
  Fly    20 ELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGK-----EESLENEI 79

Mouse    76 SILR---------------QVLHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEE 125
            .:||               ::.||||:.|.:.||:::.|.|::|||:||||||.:.:|.|.:|::
  Fly    80 RVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKD 144

Mouse   126 ATSFIKQILDGVNYLHTKKIAHFDLKPENIMLL----DKNIPIPHIKLIDFGLAHEIEDGVEFKN 186
            |:..|:|||:.|:|:|.:.:.|.||||||::..    |..|.|.     ||||: ::||......
  Fly   145 ASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMIS-----DFGLS-KMEDSGIMAT 203

Mouse   187 IFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFF 251
            ..|||.:||||::..:|.|...|:||||||:||||.|..||..:......|.|....::||..::
  Fly   204 ACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYW 268

Mouse   252 SQTSELAKDFIRKLLVKETRKRLTIQEALRHPWIT-SKGEAR--------------APEQWK-AQ 300
            .:.||.||.||:.|:.....||.|.::||.|.||: ::..:|              |..:|| |.
  Fly   269 DEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAY 333

Mouse   301 PAQLKTKRLREYTLKCHSSMPPNNTYVNFE 330
            .|....::::...|.       :|:..||:
  Fly   334 YAATVIRQMQRMALN-------SNSNANFD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dapk2XP_036010488.1 STKc_DAPK2 17..285 CDD:271098 104/287 (36%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 104/284 (37%)
S_TKc 31..302 CDD:214567 103/281 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.