DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dapk2 and CG10177

DIOPT Version :9

Sequence 1:XP_036010488.1 Gene:Dapk2 / 13143 MGIID:1341297 Length:490 Species:Mus musculus
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:287 Identity:70/287 - (24%)
Similarity:135/287 - (47%) Gaps:20/287 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 QASMRSPNMETFKQ----QKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASR 63
            |..:.|..:|:.|.    :.::.:.:..|.:......::.:.:.::...:...|.:.| |::::.
  Fly   125 QHHLDSGTLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNK-QTQSND 188

Mouse    64 RGVCREEIEREVSILRQV-LHPNIITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEAT 127
            ||    :...|..:|||: .|||||.|....|:...:..:||.:. ..:...:.::..|||.:|.
  Fly   189 RG----DTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLD-CNMQKVIQKRGILSEADAR 248

Mouse   128 SFIKQILDGVNYLHTKKIAHFDLKPENIMLLDK----NIPIPHIKLIDFGLAHEIEDGVEFKNIF 188
            |.::..:..:.::|..::.|.|:||||:::...    |..:  :|:.:|.||.... |.:.....
  Fly   249 SVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKM--VKVANFDLATYYR-GSKLYVRC 310

Mouse   189 GTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTK--QETLANITAVSYDFDEEFF 251
            |||.::|||::.......:.|.||:||..:.:|.|..||....|  :|..|.|.:....:.::..
  Fly   311 GTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDME 375

Mouse   252 SQTSELAKDFIRKLLVKETRKRLTIQE 278
            |..|..|...|..|||.:...|:.|.|
  Fly   376 SVMSPEATQLIDGLLVSDPSYRVPIAE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dapk2XP_036010488.1 STKc_DAPK2 17..285 CDD:271098 66/269 (25%)
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 65/248 (26%)
PKc_like 164..403 CDD:304357 65/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.