DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLHL40 and CG9970

DIOPT Version :10

Sequence 1:NP_689606.2 Gene:KLHL40 / 131377 HGNCID:30372 Length:621 Species:Homo sapiens
Sequence 2:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:93/252 - (36%) Gaps:70/252 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    36 VVRAGEREFPCHRLVLAACSPYF--------RARF------------LAEPERAGEL-HLEEVSP 79
            :|:.||.:|.|...:|...|.:|        |.:|            :.|..|..:| ..:|:.|
  Fly   150 LVQIGENKFKCIPCLLRCFSVWFGIRDWRITRFKFKEREVPSGGFKVVYEWMRTNKLPEFDELVP 214

Human    80 --DVVAQVLHYLYTSEI--ALDEASVQD-----LFAAAHRFQIPSIFTICVSFLQKRLCLSNCLA 135
              .|...:...|...||  .|.:.||::     ::..|.|  :|::..:|.:.|           
  Fly   215 ALQVACHLKVTLLEKEIWQILSDESVREKVAFLVYLGARR--MPALGALCEAML----------- 266

Human   136 VFRLGLLLDCARLAVAARDFICAHFTLVARDADFLGLSADELIAIISSDGLNVEKEEAVFEAVMR 200
             |||.                 .:|..:.....|:.|..|.|..::..|.:.|..|..||.||:|
  Fly   267 -FRLR-----------------KYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIR 313

Human   201 WAGSGDAEAQAERQRALPTVFESVRCRLLPRAFLESRVE--RHP----LVRAQPELL 251
            |.|......:.|..:.|   .:.||...:|..||.|..|  .||    |...:|.:|
  Fly   314 WLGHSRGRKRREHFQRL---MKCVRFHHMPMTFLFSLRESFNHPEKFDLFSKEPGML 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLHL40NP_689606.2 BTB_POZ_KLHL40_KBTBD5 6..137 CDD:349649 27/130 (21%)
PHA03098 47..551 CDD:222983 54/241 (22%)
BACK 128..230 CDD:475122 22/101 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
KELCH repeat 351..398 CDD:276965
Kelch 1 360..412
KELCH repeat 402..448 CDD:276965
Kelch 2 413..462
KELCH repeat 452..497 CDD:276965
Kelch 3 463..510
Kelch 4 512..557
Kelch_1 547..594 CDD:396078
KELCH repeat 547..594 CDD:276965
Kelch 5 559..613
CG9970NP_647754.1 BACK 254..346 CDD:197943 29/125 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.