DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab1 and Aplip1

DIOPT Version :10

Sequence 1:NP_001355978.1 Gene:Dab1 / 13131 MGIID:108554 Length:588 Species:Mus musculus
Sequence 2:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:53/134 - (39%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    41 RYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFD------- 98
            ||....:|..|..|.:|..:...::.|    :.|........|...|.:|..|:::.|       
  Fly   346 RYLLGYLGSVETLAHKGTGVVCQAVRK----IVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQN 406

Mouse    99 --EKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFV--AIKTAQAAEPVILDLRDLFQ 159
              :|...:.:.:::..:|:.|....|||..|::.......||.  ..|.:::..||...:...||
  Fly   407 KKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQ 471

Mouse   160 LIYE 163
            ..|:
  Fly   472 RFYQ 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dab1NP_001355978.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PTB_Dab 25..174 CDD:269926 28/134 (21%)
PRK07764 <288..469 CDD:236090
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..444
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..588
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.