DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp8b1 and Cyp6a8

DIOPT Version :9

Sequence 1:NP_034142.3 Gene:Cyp8b1 / 13124 MGIID:1338044 Length:500 Species:Mus musculus
Sequence 2:NP_523749.2 Gene:Cyp6a8 / 36666 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster


Alignment Length:212 Identity:57/212 - (26%)
Similarity:89/212 - (41%) Gaps:27/212 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   276 FMMLWASQGNTGPTCFWVLLFLLKHQDAMKAVREEATRVMGKARLEAKKSFTFTPSALKHTPVLD 340
            |:...|....:..|..:.|..|.|:.|....||.|...|:      .:....||....|....|:
  Fly   305 FVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVI------EQHDQNFTYECTKDLKYLN 363

Mouse   341 SVMEESLRL-CATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTAFKY 404
            .|::|:||| ...|.|.|:..:.||  :.....:.|..|..| :.|..::|.||.|:|||..|:.
  Fly   364 QVLDETLRLYTIVPNLDRMAAKRYV--VPGHPNFVIEAGQSV-IIPSSAIHHDPSIYPEPFEFRP 425

Mouse   405 DRFLNPD---GTRKVDFYKSGKKIHHYSMPWGSGVSKCPGRFFALSEMKTFVLLMIMYFDFKLVD 466
            :|| :|:   |...|.:           :|:|.|...|.|..|...:.:..:.|:|..|.|....
  Fly   426 ERF-SPEESAGRPSVAW-----------LPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCS 478

Mouse   467 PDIPVPPI-DPRRWGFG 482
             ..|.|.: ||:.:..|
  Fly   479 -KTPNPLVYDPKSFVLG 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp8b1NP_034142.3 p450 37..464 CDD:299894 52/191 (27%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 57/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6362
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.