DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a22

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster


Alignment Length:438 Identity:112/438 - (25%)
Similarity:200/438 - (45%) Gaps:69/438 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    98 DYA----KAVY--SRGDPKAAYVYDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLK---PY 153
            |:|    :.:|  .|.||...:::.            ::||||...|:.::|.|....:|   |.
  Fly    96 DFANFEDRGMYHNERDDPLTGHLFR------------IDGPKWRPLRQKMSPTFTSAKMKYMFPT 148

Mouse   154 VA-IFAESTRVMLDKWEKKASENKSFDIFCDVGHM----ALDTLMKCTFGKGDSGLSHSDNSYYL 213
            |. :..|.|:|.     .:.::|....|. ::|.:    ..|.:.:|.||...:||.:.:..:  
  Fly   149 VCEVGEELTQVC-----GELADNAMCGIL-EIGDLMARYTSDVIGRCAFGVECNGLRNPEAEF-- 205

Mouse   214 AVSDLTLLMQQR--------IDSFQYHNDFIYWLTPHGRRFLRACQIAHDHTDHVIRQRKAALQD 270
            |:.......::|        |:||           |...||||..||..|.||..:...:..::.
  Fly   206 AIMGRRAFSERRHCKLVDGFIESF-----------PEVARFLRMRQIHQDITDFYVGIVRETVKQ 259

Mouse   271 EKEQKKLQERRHLDFLDILLGARDESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYP 335
            .:||..::.    ||:::|:..:...  :|:..::.|:...|...|.||:.|.:.:.||.:|..|
  Fly   260 REEQGIVRS----DFMNLLIEMKQRG--ELTIEEMAAQAFIFFAAGFDTSASTLGFALYELAKQP 318

Mouse   336 MHQQRCREEVREILG-DRDSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS- 398
            ..|.:.|||:.:.|. ....|.:|.:.::.|:.:.:.|..|.||.:||:.| :|:.:....|.. 
  Fly   319 ALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRH 382

Mouse   399 --LPAGSLISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMN 461
              :..|.::.:.:|.:|.:.|::|:|..|.|.||..:.:..|...|::||..|||||||.:|...
  Fly   383 FYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKM 447

Mouse   462 EMKVVTALCLLRFEFS----PDPSKIPIKVPQLILRSKNGIHLYLKPL 505
            :..:.....|..|.||    .|| ||......::|...|||:|.::.|
  Fly   448 QTTIGLVSLLRNFHFSVCPRTDP-KIEFLKSNILLCPANGIYLKVQQL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 110/431 (26%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 111/433 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.