DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:536 Identity:135/536 - (25%)
Similarity:229/536 - (42%) Gaps:88/536 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 VVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWLFG---------HALEIQKTGGLDKVVTW- 73
            ::.|:|.:|.||....||:.........|....|.|||         |..||.:    |....: 
  Fly     3 LLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFR----DYYFKYK 63

Mouse    74 TEQFPYAHPLWLGQFIVFLN---IYEPDYAKAVY--------SRG-------DPKAAYVYDFFLQ 120
            ...:|:|     |.|..|..   :.:.:..|.|.        :||       ||.:|.::.    
  Fly    64 NSDYPFA-----GFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFS---- 119

Mouse   121 WIGKGLLVLEGPKWFQHRKLLTPGFHYDVLK---PYVA-IFAESTRVMLDKWEKKASENKSFDIF 181
                    :||.||...|..|||.|....:|   |.|. :..|..:|...|  ..|...:..::.
  Fly   120 --------IEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK--TAADRGQVLEVV 174

Mouse   182 CDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHN--DFIYWLTPHGR 244
            ..|.....|.:..|.||.       :.||.|...::...:.::.|...:|.|  |...:..|...
  Fly   175 DLVARYTADVIGNCAFGL-------NCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLS 232

Mouse   245 RFLRA---CQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILL-------GARDESGIK 299
            |.||.   .|.|.|....::|:    ..|.:.:.|  |:|: ||:|.|:       ....|.|:.
  Fly   233 RRLRLKLNIQEAEDFYTKIVRE----TIDYRLRTK--EKRN-DFMDSLIEMYKNEQSGNSEDGLT 290

Mouse   300 LSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRD-SFQWDDLAQM 363
            .:  :|.|:...|...|.:|:::.:.:.||.:|.....|.:.|||:..:.|..: .|.::.:.:|
  Fly   291 FN--ELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEM 353

Mouse   364 TYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPA-GSLISLHIYALHRNSAVWPDPEVFDP 427
            .||...:.|..|.||.:..:.|......:..|.:...| |:::.:....:|.:..::|:||:|.|
  Fly   354 KYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKP 418

Mouse   428 LRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDP-SKIPIK--VPQ 489
            .||:.|.:..|....::||..|||||||.:|.|.:..|..|..:..::||..| ::||:|  |..
  Fly   419 ERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKN 483

Mouse   490 LILRSKNGIHLYLKPL 505
            :::.::|||||.::.|
  Fly   484 ILISAENGIHLKVEKL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 125/501 (25%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 119/480 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.