DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9f2

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster


Alignment Length:485 Identity:115/485 - (23%)
Similarity:190/485 - (39%) Gaps:88/485 - (18%)


- Green bases have known domain annotations that are detailed below.


Mouse    51 KHWLFGHALEIQKTGGLDKVVTWTEQFPYAHPLWLGQFIVFLNIYEPDYAKAVYSRGDPKAAYVY 115
            |..:|....::...||..|.....||   ..||        |.:.:||..|.:..:.       :
  Fly    51 KRAMFDIVCDLYTKGGSKKFFGIFEQ---RQPL--------LMVRDPDLIKQITIKD-------F 97

Mouse   116 DFFL------------------QWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTR 162
            |.|:                  ...|..|..:...:|...|..|:|.|....::....:..:..:
  Fly    98 DHFINHRNVFATSSDDDPHDMSNLFGSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAK 162

Mouse   163 VMLD--KWEKKASENKSFDI--FCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQ 223
            ..:|  |.:....:....|:  :|.  ....|.:....||...:.....:|::|.....||..  
  Fly   163 EAVDCLKQDDSRVQENELDMKDYCT--RFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTF-- 223

Mouse   224 QRIDSFQYHNDFIYWLTPHG-RRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLD 287
                :|.....|:.:....| .:.|:........|.:.:|....|::..:|...::.    |.::
  Fly   224 ----TFLQSMKFMLFFALKGLNKILKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRP----DMIN 280

Mouse   288 ILLGARDESGI------------KLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMH--- 337
            :|:.||   ||            :.||.|:.|:...|.|.|.:|     |..|.|...:.:.   
  Fly   281 MLMEAR---GIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFET-----SAVLMCFTAHELMENQ 337

Mouse   338 --QQRCREEVREILGDRD----SFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTF-VD 395
              |||..|||:::  |:|    ...::.:..|.||...:.|..|.:|....|.|:.:|.:|| ||
  Fly   338 DVQQRLYEEVQQV--DQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVD 400

Mouse   396 GRSLPA--GSLISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQF 458
            |:.:..  |.:|.|.....||:...:.:|..|||.|||.||.....||.:.||..|.|||||.:|
  Fly   401 GQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRF 465

Mouse   459 AMNEMKVVTALCLLRFEFSP-DPSKIPIKV 487
            |:.|.|.|....|..:.|:| ..|.||:::
  Fly   466 ALLEAKAVIYYLLKDYRFAPAKKSCIPLEL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 115/485 (24%)
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 115/485 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.