DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:414 Identity:99/414 - (23%)
Similarity:172/414 - (41%) Gaps:51/414 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   122 IGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIF----AESTRVMLDKWEKKASENKSFDIFC 182
            |.|.||.|...:|.|.|..|||.|....::....:.    .|:...:..:.:...||.:..|.|.
  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFT 183

Mouse   183 DVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHND---FIYWLTPHGR 244
               ....|.:....||...:.....:|.::        .:.|||..|.:...   .:|.|.|...
  Fly   184 ---RYTNDVIATAAFGIQVNSFKDPNNEFF--------SIGQRISEFTFWGGLKVMLYILMPKLM 237

Mouse   245 RFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGAR-----DESG------- 297
            :.||...:..::.|:..:....|::..|||..::.    |.:.:|:.|:     ::.|       
  Fly   238 KALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRP----DMIHLLMEAQRQFKAEQEGSAESAAQ 298

Mouse   298 ---IKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREE---VREILGDRDSFQ 356
               .:.:|.||.|:...|...|.:|..:.:|:..|.:.:.|..|::...|   |:|.||:: ...
  Fly   299 QDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEK-PLD 362

Mouse   357 WDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGR-----SLPAGSLISLHIYALHRNS 416
            :|.|..|.||...:.|..|.:||...|.|.........|..     :|....|:.:::.|||.:.
  Fly   363 YDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDP 427

Mouse   417 AVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDPS 481
            ..:|:||.|.|.||..|:......|.::||..|.|:|||.:.|:.|:|.:....:||:...|.. 
  Fly   428 DNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYHLKPTD- 491

Mouse   482 KIPIKVPQLILRSKNGIHLYLKPL 505
                :.|..::.|.:|..|..:.|
  Fly   492 ----RTPADMMSSISGFRLLPREL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 97/407 (24%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 99/414 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.