DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:534 Identity:119/534 - (22%)
Similarity:216/534 - (40%) Gaps:94/534 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 ILMVTVLKLLSLLFR--RQKLARALD-SFPGPPKHWLFGHALEIQKTGGLDKVVTWTEQF----- 77
            :|:..:|.|:..|..  |..:....| ..|....|.|.|....::.....:::  ||..:     
  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEI--WTSYYNKFRG 68

Mouse    78 --PYAHPLWLGQFIVFLNIYEPDYAKAVY--------SRG-------DPKAAYVYDFFLQWIGKG 125
              |:|...|..:..||  :.|...||.:.        .||       ||            :...
  Fly    69 SGPFAGFYWFRRPAVF--VLETSLAKQILIKEFNKFTDRGFFHNPEDDP------------LSGQ 119

Mouse   126 LLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSFDIFCDVGHMALD 190
            |.:|:|.||...|..|:..|....:|.......:......|.:.:..:::...::...:.....|
  Fly   120 LFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTD 184

Mouse   191 TLMKCTFGKGDSGLSHSDNSY-YLAVSDLTLLMQQR--------IDSF-----QYHNDFIYWLTP 241
            .:..|.||...|.|...|..: .:....||   :||        ::||     :.|....  ..|
  Fly   185 VIGTCAFGIECSSLKDPDAEFREMGRRSLT---EQRLGPVGIGFVNSFPNLARRLHMKMT--AEP 244

Mouse   242 HGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDILLGARD------ESG--I 298
            ..|.|:|           ::|:..|.    :||..:   |..||:|.|:..::      :||  :
  Fly   245 IERFFMR-----------IVRETVAF----REQNNI---RRNDFMDQLIDLKNKPLMVSQSGESV 291

Mouse   299 KLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGD-RDSFQWDDLAQ 362
            .|:..::.|:...|...|.:|:::.:.:.||.:|.....|.|.|:|.:|::.. .....::.:..
  Fly   292 NLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKD 356

Mouse   363 MTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS---LPAGSLISLHIYALHRNSAVWPDPEV 424
            :.||...:.|..|||..:|.:.|:..:... |.|..   :..|..:.:...|:||:..::.:|..
  Fly   357 LVYLDQVVSETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT 420

Mouse   425 FDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSP-DPSKIPI--K 486
            |:|..||||.:..|....::||..|||||||.:|...:.::..||.:..|:||. :.:.||:  .
  Fly   421 FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYN 485

Mouse   487 VPQLILRSKNGIHL 500
            ....::.|.:||:|
  Fly   486 KEMFLIASNSGIYL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 112/503 (22%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 112/503 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.