DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:555 Identity:126/555 - (22%)
Similarity:227/555 - (40%) Gaps:123/555 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 LGLWASVVILMVTVLKLLSLLFRR-----QKLARALDSFPGPPKHWLFGHALEIQKTGGLDKVVT 72
            :|:::.::.::|.::..|.|.:||     |.|     ..|....|.|.|....:|.:.....:  
  Fly     1 MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNL-----DIPCEEPHILMGSLTGVQTSRSFSAI-- 58

Mouse    73 WTEQF-------PYAHPLWLGQ-FIVFLNIYEPDYAKAVY--------SRG-------DPKAAYV 114
            |.:.:       |:|...|..: .|:.|:|   ..||.:.        .||       ||     
  Fly    59 WMDYYNKFRGTGPFAGFYWFQRPGILVLDI---SLAKLILIKEFNKFTDRGFYHNTEDDP----- 115

Mouse   115 YDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLK-----------PYVAIFAESTRVMLDKW 168
                   :...|.:|:|.||...|..|:..|....:|           .::.:|.::.       
  Fly   116 -------LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAM------- 166

Mouse   169 EKKASENKSFDIFCDVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHN 233
             :|:...:..||   :.....|.:..|.||...|.|...:..:        .:|.:|....|.|.
  Fly   167 -EKSPIVEVRDI---LARFTTDVIGTCAFGIECSSLKDPEAEF--------RVMGRRAIFEQRHG 219

Mouse   234 DFIYWLTPHGRRFLRACQ---------IAHDHTDH----VIRQRKAALQDEKEQKKLQERRHLDF 285
                   |.|..|:.:.|         |..:..:|    ::|:..|.    :|:..:   |..||
  Fly   220 -------PIGIAFINSFQNLARRLHMKITLEEAEHFFLRIVRETVAF----REKNNI---RRNDF 270

Mouse   286 LDILLG------ARDESG--IKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCR 342
            :|.|:.      .:.|||  :.|:..::.|:...|...|.:|:::.:.:.||.:|.:...|.|.|
  Fly   271 MDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVR 335

Mouse   343 EEVREILGD-RDSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFVDGRS---LPAGS 403
            :|.:|::|. .....::.:..|.||...:.|..|||..:|.:.|:..:... |.|..   :..|.
  Fly   336 KECQEVIGKYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGM 399

Mouse   404 LISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTA 468
            .:.:...|:||:..::.:|..|:|..||||.:..|....::||..|||||||.:|...:.:...|
  Fly   400 PVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLA 464

Mouse   469 LCLLRFEFSP-DPSKIPIKVPQ--LILRSKNGIHL 500
            |.:.||:||. :.:.|||...:  .::.|:.||.|
  Fly   465 LLINRFKFSVCEQTTIPIVYSKKTFLISSETGIFL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 117/514 (23%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 117/514 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.