DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a19

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_611001.2 Gene:Cyp6a19 / 36662 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster


Alignment Length:558 Identity:136/558 - (24%)
Similarity:231/558 - (41%) Gaps:137/558 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 LGLWASVVILMV-TVLKLLSLLFRRQKLARALDSFPGPPKHWLFGHALEIQKTGGLDKVVTWT-- 74
            |||...|:.|:. .||:..:...||        ..|..|.:...|:..|:.:|..|..::..|  
  Fly     5 LGLVVGVLTLVAWWVLQNYTYWKRR--------GIPHDPPNIPLGNTGELWRTMPLAGILKRTYL 61

Mouse    75 -----EQFPYA-HPLWLGQFIVFLNIYEPDYAKAV--------YSRG-------DPKAAYVYDFF 118
                 ...|:| ..|:..::||..::   |:.|.|        :.||       ||         
  Fly    62 KFRKQTDGPFAGFYLYAMKYIVITDV---DFVKTVLIRDFDKFHDRGVYHNEKDDP--------- 114

Mouse   119 LQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFA-------ESTRVMLDKWEKKASENK 176
               :...|..:||.||...|:.||..|....:|   ::|:       |..|| :|  ||.:|.::
  Fly   115 ---LTNNLATIEGQKWKNLRQKLTHTFTSAKMK---SMFSTVLNVGDEMIRV-VD--EKISSSSQ 170

Mouse   177 SFDIFCDVGHMALDTLMKCTFG---------------KGDSGLSHSDNSYYLAVSDLTLLMQQRI 226
            :.::...|.....|.:..|.||               .|.|.|....:.:.:   ||.:....::
  Fly   171 TLEVTDIVSRFTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALRERRHGWLV---DLLIFGMPKL 232

Mouse   227 D---SFQYHNDFIYWLTPHGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHLDFLDI 288
            .   .||:       |.|..::|.  .:|..|..|:  |.::...::             ||:|.
  Fly   233 AVKLGFQF-------LLPSVQKFY--MKIVQDTIDY--RMKRKVTRN-------------DFMDT 273

Mouse   289 LLGARD-------ESGIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVR 346
            |:..:.       |:|:..:  ::.|:...|...|.:..::.:.:.||.:|.....|.:.|.|:.
  Fly   274 LIDMKQQYDKGDKENGLAFN--EVAAQAFVFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEID 336

Mouse   347 EILGDR--DSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYR------QLSKPVTFVDGRSLPAGS 403
            .:| :|  ...::|.:..:.|:...:.|..|.:|.|..:.|      |.|.|..|::     ||:
  Fly   337 SVL-ERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIE-----AGT 395

Mouse   404 LISLHIYALHRNSAVWPDPEVFDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTA 468
            .:.:....:|.:...:|:||.|.|.||..|.:..|...||:||.||||||||.:|  ..|:|:..
  Fly   396 GVLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIGLRF--GRMQVIIG 458

Mouse   469 LCLL----RFEFSPDPSKIPIK--VPQLILRSKNGIHL 500
            |.||    |||..| .:.:|:|  :..|:|.|:.||||
  Fly   459 LALLIHNFRFELHP-KTPVPMKYTINNLLLGSEGGIHL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 125/521 (24%)
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 125/521 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.