DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:381 Identity:87/381 - (22%)
Similarity:161/381 - (42%) Gaps:49/381 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   126 LLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKK----ASENKSFD----IFC 182
            |.|:....|...|.:|||.|....::....:..||....|:..:..    |.|| :|:    :.|
  Fly   119 LNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGEN-AFELDMKVLC 182

Mouse   183 DVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFL 247
            :  .::.|.:....||...:.....:|.::  ....||...:.:...::   .:..|.|....|.
  Fly   183 N--KLSNDVIATTAFGLKVNSFDDPENEFH--TIGKTLAFSRGLPFLKF---MMCLLAPKVFNFF 240

Mouse   248 RACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHL---DFLDILLGARDESGIKLSDADLRAEV 309
            :.......:.::.:|....|:|       .:|:.::   |.:.:|:.|:.||....:|.::.|:.
  Fly   241 KLTIFDSTNVEYFVRLVVDAMQ-------YREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQC 298

Mouse   310 DTFMFEGHDTTTSGISWFLYCMALYPM-----HQQRCREEVREILGDRDSFQ-----WDDLAQMT 364
            ..|.|...:..::     |.|...|.:     .|:|..|||:|   .:::.:     :|...:||
  Fly   299 FIFFFAAFENNSN-----LICTTAYELLRNLDIQERLYEEVKE---TQEALKGAPLTYDAAQEMT 355

Mouse   365 YLTMCMKECFRLYPPVPQVYRQLSKPVTFVD--GRSL---PAGSLISLHIYALHRNSAVWPDPEV 424
            |:.|.:.|..|.:.......|..:|..|..|  |..|   .||..|::.|..||.:...:|.|:.
  Fly   356 YMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQR 420

Mouse   425 FDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDP 480
            |||.|||........|:.::||..|||:|||.::|:.:.|.:....:|.::....|
  Fly   421 FDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 87/381 (23%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 87/381 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.