DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:523 Identity:153/523 - (29%)
Similarity:251/523 - (47%) Gaps:52/523 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MALSFLSPSLSRLGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWL------FGHAL 59
            |.::.|..||....||..:..|..|.. :|||.    |..|..|..|...|.::      ||:.|
  Fly     1 MWIALLGSSLLIGALWLLLRQLNKTYF-ILSLC----KRVRTADGSPLESKVFVVPGKTRFGNNL 60

Mouse    60 EIQKTGGLDKVVTWTEQFPYAHP----------LWLGQFIVFLNIYEPDYAKAVY-SRGDPKAAY 113
            ::..       :|....|.|...          :|...|....||...:.|:.:: |........
  Fly    61 DLLN-------LTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNM 118

Mouse   114 VYDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSF 178
            .|:....::|.|||:....||...||.|||.||:::|:.:::||.|.::    |:.|...:|..|
  Fly   119 SYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGF 179

Mouse   179 DIFCD--VGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTP 241
            ::..:  :....|:.:.:...|.....:|.. |.|..|:.|..::..||:.:.....::.::|..
  Fly   180 ELELNQIIPQFTLNNICETALGVKLDDMSEG-NEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFG 243

Mouse   242 HGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQE---RRHLDFLDILLGARDESGIKLSDA 303
            ..:::.|..:..|..:..:| |||.....:|:..::.|   ::....||.||.|..|.  |:...
  Fly   244 DYKKYSRILRTIHGFSSGII-QRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KIDHQ 305

Mouse   304 DLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQWDDLAQMTYLTM 368
            .:..||:||||.|:|||::.:.:.|..:||:...|:||.||::::..|.|........::.:|..
  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLEC 370

Mouse   369 CMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPEVFDPLRFSPE 433
            .:||..||:|..|.:.|...:. :.::|..||..:.||:|||.:.|::..:|.|..|.|.||.||
  Fly   371 VIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPE 434

Mouse   434 NMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDPSKIPIKVPQL-ILRSKNG 497
            |...||||||:||||||||||||:|.:.|:||:.|..:..|:..|        ..|| .|..:||
  Fly   435 NSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP--------ATQLEDLTFENG 491

Mouse   498 IHL 500
            |.|
  Fly   492 IVL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 138/475 (29%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 137/468 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.