DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a14 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:529 Identity:132/529 - (24%)
Similarity:225/529 - (42%) Gaps:71/529 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 WAFLLSLFLVLFKAVQFYLRRQWLLKTLQHF------PCMPSHWLWGHHLKDKELQQIL--IWVE 77
            ::.||::.:||..    ||..:|  :...|:      ||...|.|.| .|...:..:..  ||::
  Fly     4 YSVLLAIVVVLVG----YLLLKW--RRALHYWQNLDIPCEEPHILMG-SLTGVQTSRSFSAIWMD 61

Mouse    78 ---KF----PSACLQCLSGSNIRVLLYDPDYVKVVLGRSDPKAS--GIYQFFA--PWIGYGLLLL 131
               ||    |.|.........|.||  |....|::|.:...|.:  |.|....  |..|. |.||
  Fly    62 YYNKFRGTGPFAGFYWFQRPGILVL--DISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQ-LFLL 123

Mouse   132 NGKKWFQHRRMLTPAFHYDILK----PYVKIMADSVNIMLDKWEKLDGQDHPL-EIFHCVSLMTL 191
            :|:||...|..|:..|....:|    ..||:..:.:.:.....||     .|: |:...::..|.
  Fly   124 DGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEK-----SPIVEVRDILARFTT 183

Mouse   192 DTVMKCAFSYQGSVQLDENSKLYTKAVEDLNNLTFFRLRNAFYKYNIIYNMSSDGRLSHHACQIA 256
            |.:..|||..:.|...|..::...     :.....|..|:.......|.:..:..|..|  .:|.
  Fly   184 DVIGTCAFGIECSSLKDPEAEFRV-----MGRRAIFEQRHGPIGIAFINSFQNLARRLH--MKIT 241

Mouse   257 HEHTDGVIKMRKSQLQNEEELQKARKKRHL---DFLDILL------FARMEDRNS--LSDEDLRA 310
            .|..:...      |:...|....|:|.::   ||:|.|:      ..:.|...|  |:.|::.|
  Fly   242 LEEAEHFF------LRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAA 300

Mouse   311 EVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSILGD-GTSVTWDHLGQMPYTTMCIK 374
            :...|...|.:|:::.:.:..|.||.|.:.|.|.|:|.|.::|. ...:|::.:..|.|....|.
  Fly   301 QAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLDQVIS 365

Mouse   375 EALRLYPPVISVSRELSSPVTFPDGRS--IPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPD- 436
            |.||||..:..::||.......|....  |.||:...|....:|.:.:.:.||..|:|..|:|: 
  Fly   366 ETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPER 430

Mouse   437 -SSHHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFEL-LPDPTRIPVPIAR--LVLKSKN 497
             ....|..:|||..|.|||||.:|...:.:..:||.:.||:. :.:.|.||:..::  .::.|:.
  Fly   431 VKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSET 495

Mouse   498 GIHLCLKKL 506
            ||.|.::::
  Fly   496 GIFLKVERV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 123/485 (25%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 123/485 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.