DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a14 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:378 Identity:91/378 - (24%)
Similarity:163/378 - (43%) Gaps:49/378 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse   148 HYDILKPYVKIMADSVNIMLDK-WEKLDGQDHPLEIFHCVSLMTLDTVMKCAFSY---------- 201
            |..:..|..:::.|.:|:|.|: |..:.....|  :|....:..:.|:|..:|:.          
  Fly   104 HQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTP--VFTSAKMRNMFTLMNESFAQCLEHLKSSQP 166

Mouse   202 ----QGSVQLDENSKLYTKAVEDLNNLTFFRLR-NAF----YKYNIIYNMSSDGR----LSHHAC 253
                :.:.:|| ...|..|...|:...|.|.|: |:|    .:::.|....:..|    |....|
  Fly   167 IAAGENAFELD-MKVLCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMC 230

Mouse   254 QIAHEHTDGVIKMRKSQLQNEE-------ELQKARKKRHL---DFLDILLFARMEDRNSLSDEDL 308
            .:|.: .....|:......|.|       :..:.|:|.::   |.:.:|:.|:.|.:::.:|:::
  Fly   231 LLAPK-VFNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEI 294

Mouse   309 RAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEV---QSILGDGTSVTWDHLGQMPYTT 370
            .|:...|.|...:..::.|....|.|..:.:.|:|..|||   |..| .|..:|:|...:|.|..
  Fly   295 VAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-KGAPLTYDAAQEMTYMD 358

Mouse   371 MCIKEALRLYPPVISVSRELSSPVTFPDGR-----SIPKGITATISIYGLHHNPRFWPNPKVFDP 430
            |.|.|:||.:....:..|..:...|..|..     ....|....|.|.|||.:.||:|.|:.|||
  Fly   359 MVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDP 423

Mouse   431 SRFAPDSSHH--SHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPDP 481
            .||:......  .:.||||..|.|:|||.::|:.:.|..:...:|.:::...|
  Fly   424 ERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 91/378 (24%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 91/378 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.