DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a14 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_031848.1 Gene:Cyp4a14 / 13119 MGIID:1096550 Length:507 Species:Mus musculus
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:500 Identity:106/500 - (21%)
Similarity:202/500 - (40%) Gaps:123/500 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    69 LQQILIW----VEKFPSACLQCLSGSNI------------RVLLY--DPDYVKVVLGRSDPKASG 115
            :||.::|    :...|::.|:.:|...:            |||||  ||..::.||...:.....
  Fly    39 IQQPVLWLLLCINLHPNSILEKVSQYRVHFQRPLAVLVGTRVLLYIDDPAGMECVLNAPECLDKT 103

Mouse   116 IYQ--FFAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWE---KLDG 175
            ..|  ||   :..|||...|:||...|:.|.|||.::|:..:..:.....|.|:::::   .|.|
  Fly   104 FLQDGFF---VRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHG 165

Mouse   176 QDHPLEIFHCVSLMTLDTVMKCAFSYQGSVQLDENSKLYTKAVEDLNNLT-------FFRLRNAF 233
            |                           :|:......|.::||.:::.||       |.:|.:|.
  Fly   166 Q---------------------------AVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAH 203

Mouse   234 --YKYNIIYNMSS--------DGRLSHH------------ACQIAHEHTDGVI--KMRKSQLQNE 274
              :.|..:..:|:        ..||.|.            ..::..:...|::  |.|..:|::.
  Fly   204 IAHSYKRLLEISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDA 268

Mouse   275 -------EELQKARKKRHLDFLDILLFARMEDRNSLSDEDLRAEVDTFMFEGHDTTASGISWIFY 332
                   |:.....::|  .|::.:.  ::.....::.|::..|..:.:....:|.::.|.....
  Fly   269 VGGEKSGEDASNGWQRR--IFIEQIF--QLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALL 329

Mouse   333 ALATHP-EHQQRCREEVQSILGDGTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTF 396
            .|||:. :.|:|...|:::::.|...|..:.|.|:.|....:.|:|||...|....|.:|.....
  Fly   330 CLATNKGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRL 394

Mouse   397 PDGRS----IPKGITATISIYGLHHNPRFW-PNPKVFDPSRFAP-----------DSS------- 438
            . ||.    :|:.....:..:.:..:.|:| .|.:.|||.||..           ||.       
  Fly   395 A-GRQHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQ 458

Mouse   439 ---HHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPD 480
               .||:::||||.|.|:|||:::.:..:||.:...:..|:...|
  Fly   459 RDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a14NP_031848.1 p450 52..501 CDD:278495 105/499 (21%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 103/495 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.