DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a12b and Cyp312a1

DIOPT Version :9

Sequence 1:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus
Sequence 2:NP_001262008.1 Gene:Cyp312a1 / 40005 FlyBaseID:FBgn0036778 Length:510 Species:Drosophila melanogaster


Alignment Length:500 Identity:150/500 - (30%)
Similarity:247/500 - (49%) Gaps:33/500 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 LLLLLFKTAQLYL-HRQWLLSS-TQQFPSPPSHWLFGH-----KILKDQDLQDILTRIKNFPSAC 84
            ||||......||: .||..:.. |.::|:||:....||     |::....|:.....|.......
  Fly     8 LLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGHLHILAKLVGPHPLRRATEMINEHLHDH 72

Mouse    85 PQWLW-GSKVRIQVYDP-DYMKLILGRSDPKAHGSYRFLAPWIGRGLLLLDGQTWFQHRRMLTPA 147
            ...|| |:|:.:...:| |...|...:...:....||....|:..||.....:.|...|:::.||
  Fly    73 RAKLWMGTKLYLVDCNPKDIQALCSAQQLLQKTNDYRVFENWLCEGLFTSGFEKWSHRRKIVMPA 137

Mouse   148 FHYDILKPYTEIMADSVHVMLDKWEQIVGQDSTLEIFQHITLMTLDTIMKCAFSHEGSVQLDRKY 212
            |:|.::|.:..:......::|....:.......::..|.|:..|||||.:.|.......|...| 
  Fly   138 FNYTMIKQFVAVFEKQSRILLTNVAKFAESGDQIDFLQLISCFTLDTICETALGVSVGSQSSAK- 201

Mouse   213 KSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNGCLANSACQLAHDHTDQVIKSRRSQL-QDEE 276
            ..|:.||:.:..:...|::|||::|..|::.:|:........:..|..|:.:|:.|..:: ||.|
  Fly   202 SEYLDAVKSILVIIDKRLKNIFYRNSFIFKRTSHYKREQELIKTLHGFTEGIIQKRIDEINQDAE 266

Mouse   277 ---------ELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIF 332
                     ||:.:  ||.|.|||.||.::..:||.|:.||:|.||||.:|.|.|.||:.:::..
  Fly   267 NRNYQSSDAELDGV--KRTLCFLDTLLLSKGPDGKPLTVKDIREEVDTIIFGGFDLTATTLNFFM 329

Mouse   333 YALATNPEHQQRCRKEIQSLLGDGAS--ITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPV 395
            |.:..:||||||||:|:.|:.|...|  |:...:.::.:...||||.||:||..|..:|:.::..
  Fly   330 YNMTLHPEHQQRCREEVWSVCGKDKSEPISIEQVRQLEFLEACIKETLRMYPSGPLTARKATANC 394

Mouse   396 TFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSR--HSHSFLPFSGGARNCIGK 458
            |..| ..:|||..|::|...:......:|:|.||.|.|:|.|:..  .:.:|:||..|||:|:|:
  Fly   395 TIND-FFIPKGSDVIISPIYMGRCKDFFPDPMVFKPDRWAIGAEPKIEATTFIPFMAGARSCMGQ 458

Mouse   459 QFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLH 503
            ::||..||:.:|..|..|...|...|      ::.||....|.||
  Fly   459 RYAMVMLKMVLAHLLRNFLFEPLGER------QVKLKLNFVITLH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 133/448 (30%)
Cyp312a1NP_001262008.1 p450 35..505 CDD:278495 140/472 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.