DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a12b and Cyp316a1

DIOPT Version :9

Sequence 1:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:477 Identity:117/477 - (24%)
Similarity:205/477 - (42%) Gaps:54/477 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    55 PSHW-LFG--HKIL------KDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRS 110
            |..| |.|  ||:|      ..|...:.||:...| |.|  |:: .::.|.:.|.:..:.:| .:
  Fly    34 PFTWPLMGAMHKLLFLTPINFFQRSTEYLTKYGTF-SRC--WVF-HRLFIPLADLELSRQLL-EN 93

Mouse   111 DPKAHGSYRFLAPWIGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIV 175
            |......|..:..|:..|:|:...:.|.:...:::..|....|:...::.......:|.|..:..
  Fly    94 DTHLETGYELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQA 158

Mouse   176 GQDSTLEIFQHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDII 240
            .| ...:|:..::.:.||.::......:.|       :.|.:.::||:.::..|..::...|...
  Fly   159 DQ-KVFDIWYTVSPIVLDLMVMTTCGAKPS-------EEYSKNLKDLSEIYRKRFLSLQSANRFN 215

Mouse   241 YRVSSNGC--LANSACQLAHDHTDQVIKSRRSQLQ-------DEEELEKLKKKRRLDFLDILLFA 296
            |.:||...  ..|...:..:|..:.::...:||.|       |..:|..:..|.....|:|||.:
  Fly   216 YWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLES 280

Mouse   297 RMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGASITW 361
            :   ...|:.:::..|::|..:.|:...:..:.:....:|.||..||:|..|:.  |.......|
  Fly   281 K---DPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELN--LAQIKDQGW 340

Mouse   362 NDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRS------LPKGIHVMLSFYGLHHNP 420
             ||:|:.|....:.|.:|:|||...|.|:|..  .||...|      ||.|..:.::.|.|..|.
  Fly   341 -DLEKLNYLDAVLHETMRLYPPQVIVGRQLKK--DFPYTHSIVGDAELPCGSEIYINLYELQRNE 402

Mouse   421 TVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLP--DPT 483
            ..:|....||..||.....    ..|.:|.|.|.|..::|:|..||..:|..|..||:||  |..
  Fly   403 VRYPKANHFDAQRFLDSPP----ELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEV 463

Mouse   484 RVPIPIPRIVLKSKNGIHLHLK 505
            |:.:   |:||.|.||..|.||
  Fly   464 RLDL---RLVLGSSNGFQLALK 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 106/449 (24%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 108/456 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.