DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a12b and Cyp9c1

DIOPT Version :9

Sequence 1:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:432 Identity:111/432 - (25%)
Similarity:177/432 - (40%) Gaps:88/432 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   125 IGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIM-------ADSVHVMLDKWEQIVGQDSTLE 182
            |.:.||.|..:.|.|.|..|||.|....::...|::       .|.|...||      ...|.||
  Fly   119 ISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLD------AGTSELE 177

Mouse   183 IFQHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVSSNG 247
            :....|..|.|.|...||..:            :.:.:|.||.||          .|..|:|...
  Fly   178 LKDFFTRYTNDVIATAAFGIQ------------VNSFKDPNNEFF----------SIGQRISEFT 220

Mouse   248 CLANSACQLAHDHTDQVIKSRRSQLQDEEELE----------KLKKKR---RLDFLDILLFAR-- 297
            ........| :....:::|:.|..:.|...::          |.:|::   |.|.:.:|:.|:  
  Fly   221 FWGGLKVML-YILMPKLMKALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQ 284

Mouse   298 -------------MENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEI 349
                         .::....:|.||.|:...|...|.:|.|:.:|:..|.|..|||.|::...||
  Fly   285 FKAEQEGSAESAAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEI 349

Mouse   350 QSL---LGDGASITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGR-----SLPKG 406
            .::   ||: ..:.::.|..|.|....:.|:||.:||...|.|...|.....|..     :|.:.
  Fly   350 LAVKEQLGE-KPLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLRED 413

Mouse   407 IHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSH-----SFLPFSGGARNCIGKQFAMNELK 466
            ..|.::...|||:|..:|.||.|.|.||   ...|.|     ::|||..|.|:|||.:.|:.|:|
  Fly   414 DLVHINVGALHHDPDNFPEPEQFRPERF---DEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVK 475

Mouse   467 VAVALTLLRFELLP-DPTRVPIPIPRIVLKSKNGIHLHLKKL 507
            ..:...:||:.|.| |.|      |..::.|.:|..|..::|
  Fly   476 SLIFQLVLRYHLKPTDRT------PADMMSSISGFRLLPREL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 109/426 (26%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 111/432 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.