DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a12b and Cyp9b1

DIOPT Version :9

Sequence 1:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:521 Identity:110/521 - (21%)
Similarity:210/521 - (40%) Gaps:103/521 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 YLQVASVLSLL-LLLFKTA----------QLYLHRQW------LLSSTQ---------QFPSPPS 56
            ::::..||:.: |||||.:          .||..:.:      ..|:.|         :|.:...
  Fly     3 FVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTR 67

Mouse    57 HWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYD--PDYMKLILGRSDPKAHGSYR 119
            |    ||::...:|:..:.:|.:     ||.:  .|:.::.:|  |::..|.:    |...    
  Fly    68 H----HKLVGLFNLRTPMIQIND-----PQLI--KKICVKDFDHFPNHQTLNI----PNER---- 113

Mouse   120 FLAPWIGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLD---KWEQIVGQDSTL 181
                .:...|.::..|.|...|.:|||.|....::....:|.:|....|:   ..:.|...::..
  Fly   114 ----LVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAF 174

Mouse   182 EIFQHITLMTL--DTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNNLFFLRVRNIFHQNDIIYRVS 244
            |:...:....|  |.|...||..:            :.:.:|..|.|....:.:.....:.:   
  Fly   175 ELDMKVLCNKLSNDVIATTAFGLK------------VNSFDDPENEFHTIGKTLAFSRGLPF--- 224

Mouse   245 SNGCLANSACQLAHDHTDQVIKSRRSQLQDEEELE----------KLKKKR---RLDFLDILLFA 296
                |....|.||    .:|....:..:.|...:|          :.::|.   |.|.:.:|:.|
  Fly   225 ----LKFMMCLLA----PKVFNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEA 281

Mouse   297 RMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCR---KEIQSLLGDGAS 358
            :.|:..:.:|.::.|:...|.|...:..::.|....|.|..|.:.|:|..   ||.|..| .||.
  Fly   282 KKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-KGAP 345

Mouse   359 ITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPD--GRSL---PKGIHVMLSFYGLHH 418
            :|::...:|.|..|.|.|:||.:....:..|..:...|..|  |..|   ..|.::.:...|||.
  Fly   346 LTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHW 410

Mouse   419 NPTVWPNPEVFDPSRFAPGSSRH--SHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPD 481
            :...:|.|:.|||.||:....:.  .:::|||..|.|:|||.::|:.:.|..:...:|.:::...
  Fly   411 DERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEAS 475

Mouse   482 P 482
            |
  Fly   476 P 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 95/443 (21%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 101/487 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.